PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca43705.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 330aa    MW: 36894.3 Da    PI: 6.8466
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca43705.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.72.1e-20253286134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 Cs+C++tkTp+WR gp+g+ktLCnaCG+++++ +
  Dca43705.1 253 CSHCQVTKTPQWRAGPNGPKTLCNACGVRFKSGR 286
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.6E-712327IPR016679Transcription factor, GATA, plant
SMARTSM004011.1E-15247301IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.57E-14247309No hitNo description
PROSITE profilePS5011411.873247283IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.3E-15251284IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.05E-14252309No hitNo description
PROSITE patternPS003440253278IPR000679Zinc finger, GATA-type
PfamPF003204.1E-18253286IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MECMEAKALK SSFCTKTAMK SVNPHGISDD FWCVTGLPGD DFVVDDFFNL PNEENPNNNN  60
NNDDKTLNFD LFPENNGEED DEEDEEKHRN SCASQDTFSA HLAIPDDDMQ ELELWSHFMD  120
DSVPEPMLSY PKPITDSCST KTGFTFVNRV EPFKKQRFER ASFFPTVVPV KPRSKRLRSI  180
GNRSWLTGSP PKTESSSSSS PSSPVSTLLF APPVREPGVF FVYGKPPVKK PKKKPASSLD  240
GEAGLNLSVQ RRCSHCQVTK TPQWRAGPNG PKTLCNACGV RFKSGRLFPE YRPACSPTFS  300
SEVHSNSHRK VLEMRRQKEM TEPSPLGSSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1227234VKKPKKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690771.11e-102PREDICTED: GATA transcription factor 7-like
TrEMBLA0A0K9QTQ31e-107A0A0K9QTQ3_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-44GATA transcription factor 5